Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium limicola Undecaprenyl-diphosphatase (uppP)

This Recombinant Chlorobium limicola Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B3EEG6

Expression Region

1-283

Origin

Chlorobium limicola (strain DSM 245 / NBRC 103803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLFEAVILGIVQGLTEFLPISSTAHLRIIPALAGWKDPGAAFTAIVQIGTLAAVLIYFF RDITAIVREVVAGILKGRPLGTTEAKMGWMIAAGTIPIVIFGLLFKNEIETSLRSLYWIS GALIGLALLLTIAEKRMKNQLRQGVTMKSMENIGWKDALLIGLIQSIALIPGSSRSGVTI TGGLFLNLSRETAARFSFLLSLPSVLAAGVFQLYKSWDLIISSPDNLIAIIVATIVSGIV GYASIAFLLNYLKSHTTSVFIIYRLLLGSGILLMLATGMLPAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF488A conjugate, 0.1mg/mL
BNC880195-100 1x 100 µL

CD66 (CEA) (C66/195), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF647 conjugate, 0.1mg/mL
BNC470780-100 1x 100 µL

HSP60 (HSPD1/780), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (NKI-C3), CF405S conjugate, 0.1mg/mL
BNC040186-100 1x 100 µL

CD63 (NKI-C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL
BNC042540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details