Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 45B (tmem45b)

This Recombinant Danio rerio Transmembrane protein 45B (tmem45b) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Transmembrane protein 45B

UniProt

Q6P0S3

Expression Region

1-283

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANFKGHALPGTFFLLFGLWWSIKCPFRQILRRKERQVGDRERQKLTALFNRIDLIEGSL KIFFAFVGIMAEQFVPDGPHAHLYQDGWVKLMNWQHSTMYLFYGISGIADVLSVSSHHVP VGLDRLFLSLALFVEGFLFYFHIHNREPLDQHIHSLLLFAVFGGSASTMMEVFKRENAVL ELLRCTLAILQGTWFYQIGFVLYPLSGPEWDLTRHDNIMFITMCFCWHLAVALLIVGICY CGVFWTSKWCERRQRGDMEMGLRKSTSTDSSSQKALLQESDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1123), CF740 conjugate, 0.1mg/mL
BNC741123-100 1x 100 µL

TOX3 (TOX3/1123), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL
BNC882053-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (DF1513), CF568 conjugate, 0.1mg/mL
BNC680188-100 1x 100 µL

CD71 (DF1513), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details