Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3AZZ7

Expression Region

1-283

Origin

Synechococcus sp. (strain CC9902)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDTTAPLSLLEALVLGIVQGLTEFLPISSTAHLRVVPALLGWDDPGVSVTAAIQLGSVA AVIAYFRRDLTQVLTGISRAVRHGQWRDPDARLGVAMVIGTLPILVLGLGIKFFWHAGYA SSPLRSVPSIAIVSIVMALFLAMAECMGPRLKQLGGVTGRDGFVVGLAQALAVIPGVSRS GSTLTASLFDGWNRADAARFSFLLGIPAISIAGLVELKSALSTSAGAGPLPLLVGIFSAA VVSWLAIDWLLRFLQRNSTWIFVGYRLVFGAGLLVWWAFKSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyrilamine Maleate Salt
TRC-P997225-5G 5 g

Pyrilamine Maleate Salt

Sign In for Pricing
View Details
Human C17orf57 (EFCAB13) activation kit by CRISPRa
GA114877 1 Kit

Human C17orf57 (EFCAB13) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Bromo-4-nitrobenzoic Acid
TRC-B686215-5G 5 g

2-Bromo-4-nitrobenzoic Acid

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 2 (ACE2) Rabbit Polyclonal Antibody
AP20785PU-N 100 µg

Angiotensin Converting Enzyme 2 (ACE2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human VWFCP/ADAMTS13 protein (His tag)
PDEH100888-01 20 µg

Recombinant Human VWFCP/ADAMTS13 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human VWFCP/ADAMTS13 protein (His tag)
PDEH100888-02 100 µg

Recombinant Human VWFCP/ADAMTS13 protein (His tag)

Sign In for Pricing
View Details