Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid-like protease 2 (ROM2)

This Recombinant Rhomboid-like protease 2 (ROM2) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Rhomboid-like protease 2, EC= 3.4.21.105

UniProt

Q695T9

Expression Region

1-283

Origin

Toxoplasma gondii

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANIRTLSDYASSPPRGSSALEGEVGQGGSPLPLFFPSGTQSGENVSWIQWLCPGIHLKS PIIIISFVQIAVYIASLAAGLAPNEILAPTPQTLVMFGANIPELIRVGEIWRLICPLFLH LNLFHILMNLWVQIRIGLTMEEKYGWKMLLAVYFGVGVLANMISAAVLFCGQMKAGASTA VFALIGVQLAELALIWHAIQDRNSAIISVCICLFFVFVSSFGSHMDSVGHIGGLVMGFAA GIWLNENSDIKPTWYDRARLTSQVALAAAPILSCIFIFLVPRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT25 Antibody
OACD05072-100UL 100 µL

KRT25 Antibody

Sign In for Pricing
View Details
Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial
MBS962981-01 0.02 mg (E-Coli)

Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial

Sign In for Pricing
View Details
Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial
MBS962981-02 0.02 mg (Yeast)

Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial

Sign In for Pricing
View Details
Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial
MBS962981-03 0.1 mg (E-Coli)

Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial

Sign In for Pricing
View Details
Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial
MBS962981-04 0.1 mg (Yeast)

Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial

Sign In for Pricing
View Details
Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial
MBS962981-05 0.02 mg (Baculovirus)

Recombinant Human 5,6-dihydroxyindole-2-carboxylic acid oxidase (TYRP1), partial

Sign In for Pricing
View Details