Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid-like protease 2 (ROM2)

This Recombinant Rhomboid-like protease 2 (ROM2) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Rhomboid-like protease 2, EC= 3.4.21.105

UniProt

Q695T9

Expression Region

1-283

Origin

Toxoplasma gondii

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANIRTLSDYASSPPRGSSALEGEVGQGGSPLPLFFPSGTQSGENVSWIQWLCPGIHLKS PIIIISFVQIAVYIASLAAGLAPNEILAPTPQTLVMFGANIPELIRVGEIWRLICPLFLH LNLFHILMNLWVQIRIGLTMEEKYGWKMLLAVYFGVGVLANMISAAVLFCGQMKAGASTA VFALIGVQLAELALIWHAIQDRNSAIISVCICLFFVFVSSFGSHMDSVGHIGGLVMGFAA GIWLNENSDIKPTWYDRARLTSQVALAAAPILSCIFIFLVPRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP12-set siRNA/shRNA/RNAi Lentivector (Human)
11646091 4x 500 ng

AKAP12-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Mouse Cerebellin-1, Cbln1 ELISA KIT
ELI-50237m 96 Tests

Mouse Cerebellin-1, Cbln1 ELISA KIT

Sign In for Pricing
View Details
REG4 ELISA Kit (Human) (OKCD07692)
OKCD07692 96 Well

REG4 ELISA Kit (Human) (OKCD07692)

Sign In for Pricing
View Details
C8orf84 Rabbit pAb, PE-Cy5.5 conjugated
orb2860782 100 µL

C8orf84 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD5 Antibody (CD5/54/F6) [Alexa Fluor 405]
NBP2-34593AF405 0.1 mL

Mouse Monoclonal CD5 Antibody (CD5/54/F6) [Alexa Fluor 405]

Sign In for Pricing
View Details
Anti-hnRNP A2B1 Rabbit pAb
GB113586 100 μL

Anti-hnRNP A2B1 Rabbit pAb

Sign In for Pricing
View Details