Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-46 (srg-46)

This Recombinant Serpentine receptor class gamma-46 (srg-46) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-46, Protein srg-46

UniProt

P91994

Expression Region

1-283

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLMLIWMSYGPISIALSVVIFCILAVSLKFKSIFYRIVQFDILMNTVFYVNCITYKLK TIEEYHRVLLLIFESYPSLFILREGLSFWAYRFQCSSLLLKCIFRFTYAKYPFAAEIWKK HYRLIMVSTIFYSILLTIPFVFITKEHHGFDYYAFTMNIETVIYLLLTIYLGRLTKLSLK KRSKRFAESIKKLNNYIYCDLFIHGVAFFGVMIPKMLSFEWTEETKDYILTFTVDAINLA STYIIIICDSNLRKILFCHTKKLTTSVFQVSAVPVSKLIVSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio fischeri [Protein-PII] uridylyltransferase (glnD), partial
MBS1457377 Inquire

Recombinant Vibrio fischeri [Protein-PII] uridylyltransferase (glnD), partial

Sign In for Pricing
View Details
Pde1a siRNA Oligos set (Rat)
36277176 3x 5 nmol

Pde1a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Tert-Butyl (2-amino-4- (thiophen-2-yl) phenyl) carbamate
OR1005889-01 250 mg

Tert-Butyl (2-amino-4- (thiophen-2-yl) phenyl) carbamate

Sign In for Pricing
View Details
Tert-Butyl (2-amino-4- (thiophen-2-yl) phenyl) carbamate
OR1005889-02 1 g

Tert-Butyl (2-amino-4- (thiophen-2-yl) phenyl) carbamate

Sign In for Pricing
View Details
Trk A (phospho Tyr496) Polyclonal Antibody
E20-61165 100 µg

Trk A (phospho Tyr496) Polyclonal Antibody

Sign In for Pricing
View Details
TUBA1A Antibody
orb672152-01 50 µg

TUBA1A Antibody

Sign In for Pricing
View Details