Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-46 (srg-46)

This Recombinant Serpentine receptor class gamma-46 (srg-46) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-46, Protein srg-46

UniProt

P91994

Expression Region

1-283

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLMLIWMSYGPISIALSVVIFCILAVSLKFKSIFYRIVQFDILMNTVFYVNCITYKLK TIEEYHRVLLLIFESYPSLFILREGLSFWAYRFQCSSLLLKCIFRFTYAKYPFAAEIWKK HYRLIMVSTIFYSILLTIPFVFITKEHHGFDYYAFTMNIETVIYLLLTIYLGRLTKLSLK KRSKRFAESIKKLNNYIYCDLFIHGVAFFGVMIPKMLSFEWTEETKDYILTFTVDAINLA STYIIIICDSNLRKILFCHTKKLTTSVFQVSAVPVSKLIVSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

786-O/RFP stable cell line
GTR15423819 1 Vial

786-O/RFP stable cell line

Sign In for Pricing
View Details
Anti-TWEAK Antibody
MBS821474-01 0.03 mL

Anti-TWEAK Antibody

Sign In for Pricing
View Details
Anti-TWEAK Antibody
MBS821474-02 0.05 mL

Anti-TWEAK Antibody

Sign In for Pricing
View Details
Anti-TWEAK Antibody
MBS821474-03 0.1 mL

Anti-TWEAK Antibody

Sign In for Pricing
View Details
Anti-TWEAK Antibody
MBS821474-04 0.2 mL

Anti-TWEAK Antibody

Sign In for Pricing
View Details
Anti-TWEAK Antibody
MBS821474-05 5x 0.2 mL

Anti-TWEAK Antibody

Sign In for Pricing
View Details