Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (outO)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (outO) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Pectic enzymes secretion protein outO, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, P

UniProt

P31711

Expression Region

1-283

Origin

Erwinia chrysanthemi

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIAFANTFPRVWLLALLLLGLIIGSFLNVVIYRLPLMLERSWRQEARFHLGLPAGRPL ARYDLCWPPSSCPHCHQRLRMRDNIPLLSWIWLRGRAHCCGGAVSWRYPLIELLSGLSFL LAGLLWQPGLALLGALLCFGIFVALAAIDARTQLLPDVMTLPLLWGGLLFNLADTFVPLE QAVVGAVAGYLSLWLIYWAFRLLSGREALGHGDFKLLAALGAWLGWQALPNLVLIASLTG LTATLLWQRIHRLSMQQPLAFGPWLAVSGAMGLVLNVLGGWSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DNA Damage Inducible Transcript 3 (DDIT3) ELISA Kit
RDR-DDIT3-Mu-48Tests 48 Tests

Mouse DNA Damage Inducible Transcript 3 (DDIT3) ELISA Kit

Sign In for Pricing
View Details
KLK11 Protein Vector (Mouse) (pPB-C-His)
PV194782 500 ng

KLK11 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
NGFR (Tumor Necrosis Factor Receptor Superfamily Member 16, Gp80-LNGFR, Low Affinity Neurotrophin Receptor p75NTR, Low-affinity Nerve Growth Factor Receptor, NGF Receptor, p75 ICD, CD271, TNFRSF16) (HRP) discontinued
217590-HRP 100 µL

NGFR (Tumor Necrosis Factor Receptor Superfamily Member 16, Gp80-LNGFR, Low Affinity Neurotrophin Receptor p75NTR, Low-affinity Nerve Growth Factor Receptor, NGF Receptor, p75 ICD, CD271, TNFRSF16) (HRP) discontinued

Sign In for Pricing
View Details
Rat sCD21 ELISA Kit
MBS037383-01 48 Well

Rat sCD21 ELISA Kit

Sign In for Pricing
View Details
Rat sCD21 ELISA Kit
MBS037383-02 96 Well

Rat sCD21 ELISA Kit

Sign In for Pricing
View Details
Rat sCD21 ELISA Kit
MBS037383-03 5x 96 Well

Rat sCD21 ELISA Kit

Sign In for Pricing
View Details