Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (outO)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (outO) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Pectic enzymes secretion protein outO, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, P

UniProt

P31711

Expression Region

1-283

Origin

Erwinia chrysanthemi

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIAFANTFPRVWLLALLLLGLIIGSFLNVVIYRLPLMLERSWRQEARFHLGLPAGRPL ARYDLCWPPSSCPHCHQRLRMRDNIPLLSWIWLRGRAHCCGGAVSWRYPLIELLSGLSFL LAGLLWQPGLALLGALLCFGIFVALAAIDARTQLLPDVMTLPLLWGGLLFNLADTFVPLE QAVVGAVAGYLSLWLIYWAFRLLSGREALGHGDFKLLAALGAWLGWQALPNLVLIASLTG LTATLLWQRIHRLSMQQPLAFGPWLAVSGAMGLVLNVLGGWSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLG sgRNA CRISPR Lentivector (Human) (Target 1)
K0786902 1.0 µg DNA

FLG sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
1,2-Epoxyhexadecane
OR95578 1 Each

1,2-Epoxyhexadecane

Sign In for Pricing
View Details
PTPN6 discontinued
393523 200 µL

PTPN6 discontinued

Sign In for Pricing
View Details
Mcat Mouse Gene Knockout Kit (CRISPR)
KN509860 1 Kit

Mcat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lsmd1 3'UTR Luciferase Stable Cell Line
TU112684 1.0 mL

Lsmd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DUT Protein Vector (Rat) (pPM-C-His)
PV265141 500 ng

DUT Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details