Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermofilum pendens Digeranylgeranylglyceryl phosphate synthase (Tpen_1449)

This Recombinant Thermofilum pendens Digeranylgeranylglyceryl phosphate synthase (Tpen_1449) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A1S066

Expression Region

1-284

Origin

Thermofilum pendens (strain Hrk 5)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSSLPGALFQRVADWLRLLRAGNCAVVSLGAYTGYVAGRGGSLPQGVLVAASAALVAAW GNIVNDYFDLESDAISKPWRPLPSRRISPGSAVSASLPLLAAGLALGFLVSPLCGFTAVL ASALLFLYSWRVKALGLPGNVLIAFLAALNVVYGALASPEPWRSLLPSAYAFLIILGREV LKGVEDLEGDAARGVKTVASTLGARAALRVSAVLLLAVVALSPLPLLSGYGALYALFAFG GVDAPIALALLKAGPEPRRAWIATRILKVPLLMGLLAFLVGGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-500 1x 500 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-100 1x 100 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details