Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. ATP synthase subunit a (atpB)

This Recombinant Frankia sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2J6M7

Expression Region

1-284

Origin

Frankia sp. (strain CcI3)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVLADEGFEGPTKEVFQTPHWFDVGIGSVNLYLNKATALTIFAALFVGVIFWLGFRRAK IIPRGLQNLCESAYDFIDLQIARGVIGEKGTRYTPYLLVLFSFVLICNVLAVVPGAQFPA TSRIAVPMVLALVTYVLFNYAGIKANGAGPYFKEMIDPAPTAPLWIRVLLAPIEILSTLI VRPFTLAVRLFANMFAGHILLLVFSLGADYLLPKPPYVFGAASLLVAIILTAFELVIDAL QAYIITILTAAYIGGAMVHGEHEVAPSEELASPAPAGVPVSARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX16 rabbit pAb
UB-GEN-8286 100 µL

COX16 rabbit pAb

Sign In for Pricing
View Details
Ndufb4 Rat shRNA Plasmid (Locus ID 288088)
TR703456 1 Kit

Ndufb4 Rat shRNA Plasmid (Locus ID 288088)

Sign In for Pricing
View Details
Eif5 Antibody - C-terminal region : HRP (ARP38161_P050-HRP)
ARP38161_P050-HRP 100 µL

Eif5 Antibody - C-terminal region : HRP (ARP38161_P050-HRP)

Sign In for Pricing
View Details
Anti-Cathepsin K (CTSK)
FY-AB48527-01 1 mL

Anti-Cathepsin K (CTSK)

Sign In for Pricing
View Details
Anti-Cathepsin K (CTSK)
FY-AB48527-02 100 µL

Anti-Cathepsin K (CTSK)

Sign In for Pricing
View Details
Anti-Cathepsin K (CTSK)
FY-AB48527-03 200 µL

Anti-Cathepsin K (CTSK)

Sign In for Pricing
View Details