Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. ATP synthase subunit a (atpB)

This Recombinant Frankia sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2J6M7

Expression Region

1-284

Origin

Frankia sp. (strain CcI3)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVLADEGFEGPTKEVFQTPHWFDVGIGSVNLYLNKATALTIFAALFVGVIFWLGFRRAK IIPRGLQNLCESAYDFIDLQIARGVIGEKGTRYTPYLLVLFSFVLICNVLAVVPGAQFPA TSRIAVPMVLALVTYVLFNYAGIKANGAGPYFKEMIDPAPTAPLWIRVLLAPIEILSTLI VRPFTLAVRLFANMFAGHILLLVFSLGADYLLPKPPYVFGAASLLVAIILTAFELVIDAL QAYIITILTAAYIGGAMVHGEHEVAPSEELASPAPAGVPVSARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebf1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4716604 1.0 µg DNA

Ebf1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
P2RY12 AAV Vector (Rat) (CMV)
35868106 1 µg

P2RY12 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SLC9A3R2 Rabbit Polyclonal Antibody
E10G11113 100 µL

SLC9A3R2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
B3GALNT2 Peptide
DF15917-BP 1 mg

B3GALNT2 Peptide

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Cysteine desulfurase (iscS)
MBS1406294-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Cysteine desulfurase (iscS)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Cysteine desulfurase (iscS)
MBS1406294-02 0.02 mg (Yeast)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Cysteine desulfurase (iscS)

Sign In for Pricing
View Details