Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Halorhodopsin (hop)

This Recombinant Halobacterium sp. Halorhodopsin (hop) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

P33742

Expression Region

1-284

Origin

Halobacterium sp. (strain SG1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIETAAADILAGGMVPLEMTQTQIFEAVQSDTLLASSLWINIALAGLSILLFVYMGRNVE DPRAQLIFVATLMVPLVSISSYTGLVSGLTVSFLEMPAGHALAGQEVLTPWGRYLTWALS TPMILIAVGLLAGSNTTKLFTAVVADIGMCVTGLAAALTTSSYLLRWVWYAISCAFFVVV LYILLAEWAEDAEIAGTADIFNTLKVLTVVLWLGYPIFWALGAEGLAVLDVAITSWAYSG MDIVAKYLFAFLLLRWVVNNERTVADVASGLGSGSRGGAAPADD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp6ap2 Mouse Gene Knockout Kit (CRISPR)
KN301806LP 1 Kit

Atp6ap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Trp53rka Mouse Gene Knockout Kit (CRISPR)
KN500299 1 Kit

Trp53rka Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561127 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
MAGic Clamp™ Tube Rack, 12 x 1.5/2.0ml tubes, horizontal
H1000-MR-T15H 1 Each

MAGic Clamp™ Tube Rack, 12 x 1.5/2.0ml tubes, horizontal

Sign In for Pricing
View Details
SH3KBP1 (NM_001024666) Human Recombinant Protein
TP315701M 100 µg

SH3KBP1 (NM_001024666) Human Recombinant Protein

Sign In for Pricing
View Details
ARG2 Rabbit Monoclonal Antibody [Clone ID: 23GB655]
TA424522 100 µL

ARG2 Rabbit Monoclonal Antibody [Clone ID: 23GB655]

Sign In for Pricing
View Details