Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Halorhodopsin (hop)

This Recombinant Halobacterium sp. Halorhodopsin (hop) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

P33742

Expression Region

1-284

Origin

Halobacterium sp. (strain SG1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIETAAADILAGGMVPLEMTQTQIFEAVQSDTLLASSLWINIALAGLSILLFVYMGRNVE DPRAQLIFVATLMVPLVSISSYTGLVSGLTVSFLEMPAGHALAGQEVLTPWGRYLTWALS TPMILIAVGLLAGSNTTKLFTAVVADIGMCVTGLAAALTTSSYLLRWVWYAISCAFFVVV LYILLAEWAEDAEIAGTADIFNTLKVLTVVLWLGYPIFWALGAEGLAVLDVAITSWAYSG MDIVAKYLFAFLLLRWVVNNERTVADVASGLGSGSRGGAAPADD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD153 (TNFSF8) Human Recombinant Protein
TP723961 100 µg

CD153 (TNFSF8) Human Recombinant Protein

Sign In for Pricing
View Details
P2RX7 Human Gene Knockout Kit (CRISPR)
KN422143 1 Kit

P2RX7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Uchl5 activation kit by CRISPRa
GA205859 1 Kit

Mouse Uchl5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human CSF3R/G-CSFR/CD114, C-His Tag
HA211262-01 20 µg

Human CSF3R/G-CSFR/CD114, C-His Tag

Sign In for Pricing
View Details
Human CSF3R/G-CSFR/CD114, C-His Tag
HA211262-02 50 µg

Human CSF3R/G-CSFR/CD114, C-His Tag

Sign In for Pricing
View Details
Human CSF3R/G-CSFR/CD114, C-His Tag
HA211262-03 100 µg

Human CSF3R/G-CSFR/CD114, C-His Tag

Sign In for Pricing
View Details