Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconacetobacter diazotrophicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Gluconacetobacter diazotrophicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A9HI81

Expression Region

1-285

Origin

Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSRTMTLIQAIVIAILQGATELFPVSSLGHAVIVPALLGWAFDPHGEIFLPFLVMLHLG TAIALLVYFRNDWAAIFQGLRGRDGSQRQAESIHILALLVVATIPAVIIGGLLEHWLRAL FGTARYAAIFLFLNGLLLLLTERMKSRQPVQGGYAIASLTYADAAIIGLWQCLAFLPGIS RSGATIIGALFRGLNHEGAARFSFLMAQPVIIAATVREALHMRHVAIPPGQMQVATIGAM VAAVTALASTAFLMRYFHNHERWALSPFGYYCVLAGAVSFFILGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (p120) (CTNNB1/2099), CF740 conjugate, 0.1mg/mL
BNC742099-100 1x 100 µL

Catenin, beta (p120) (CTNNB1/2099), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF405S conjugate, 0.1mg/mL
BNC042278-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details