Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erythrobacter litoralis Undecaprenyl-diphosphatase (uppP)

This Recombinant Erythrobacter litoralis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q2N736

Expression Region

1-285

Origin

Erythrobacter litoralis (strain HTCC2594)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFLQLLIIAVVQGITEFLPISSSGHLILIPNFTEFPDQGPLIDVAVHVGSLLAIIVYFF KDVLTLARGGFASIGIGTDRPDAPSERRLFWWIVLGTIPAVAFGLAIKLGAFNSIAETWF NITVIDDDLMSSIRFTDLIAFNLIVYGIALGLADWLGKEVKKFEDMSWRDGLIVGIAQAL AIIPGTSRSGVTMTAARALGYSRYESARFSFLLSIPAVAGAGVLIVPEIFEAGATLAMDA LIAGVLTFIAAFLTMAFLMNFLKRASMLVFVFYRVAMGCALLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(9Z,26Z)-Pentatriaconta-9,26-dien-18-one
TRC-P284990-5MG 5 mg

(9Z,26Z)-Pentatriaconta-9,26-dien-18-one

Sign In for Pricing
View Details
IL15 Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF807772 100 µg

IL15 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714054 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
SLC25A45 (NM_001077241) Human Over-expression Lysate
LY421389 100 µg

SLC25A45 (NM_001077241) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ppp1r15a activation kit by CRISPRa
GA202781 1 Kit

Mouse Ppp1r15a activation kit by CRISPRa

Sign In for Pricing
View Details
MEK2 (MAP2K2) (NM_030662) Human Over-expression Lysate
LC403069 20 µg

MEK2 (MAP2K2) (NM_030662) Human Over-expression Lysate

Sign In for Pricing
View Details