Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium extorquens Methylamine utilization protein mauF (mauF)

This Recombinant Methylobacterium extorquens Methylamine utilization protein mauF (mauF) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Methylamine utilization protein mauF

UniProt

Q49123

Expression Region

1-285

Origin

Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLTPPAGSEVIPFASVHTERVEDCLVFPSELSTKVRLGGLVTAVSGGILGAALLSQTS SQGVAVPALLMGLSFVGGLLSTWSPCGYSSLCLLRPVGPYSARSLVKYTPTFLLHGIGYA VGALILGCVLGIAGGLLGFGGVSFGALAGLGAAGIIYGAHQLGFLRVPYPQRRAQVPHDA RQRFPVWFIGGLYGLSLGLNYLTYVQTPILYLVTAAAVLSSNIGAAILLFAAFNAGRFLP MAVNYLPVSDITVQNWLARRQEGAALLDGVLLVAGGAALLTFAAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-SLC6A19 antibody
SL0478R-01 50 µL

Rabbit Anti-SLC6A19 antibody

Sign In for Pricing
View Details
Rabbit Anti-SLC6A19 antibody
SL0478R-02 100 µL

Rabbit Anti-SLC6A19 antibody

Sign In for Pricing
View Details
ATXN2L CRISPR Activation Plasmid (h)
sc-406313-ACT 20 µg

ATXN2L CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Krt25 (NM_133730) Mouse Tagged ORF Clone Lentiviral Particle
MR207124L3V 200 µL

Krt25 (NM_133730) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nanos3 3'UTR Luciferase Stable Cell Line
TU113827 1.0 mL

Nanos3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Metazachlor-d6
HY-136373S 1 mg

Metazachlor-d6

Sign In for Pricing
View Details