Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zinc transporter ZupT (zupT)

This Recombinant Zinc transporter ZupT (zupT) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Zinc transporter ZupT

UniProt

Q8XMG8

Expression Region

1-285

Origin

Clostridium perfringens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGGDNMNNVLMAFLLTLLAGLATGIGSCIAFFAKKTNKKFLCVSLGFSAGVMIYVSMIE MFQTAKESLVGVMGIKAGNWITVISFFAGIAIIALIDKFVPEEENPHEVRSVEEVENEIE EYKGENKEGKADIKDKTLMRTGIVTALAIAIHNFPEGLATFVSALEGASLAIPITIAIAI HNIPEGISVSVPIFYATGDKKKAFLYSFLSGMSEPIGAIIGYTLLRNIFNDITLGILLSA VAGIMVFISLDELLPTARKYGEHHLAIYGLIAGMVVMAVSLLLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung: right upper lobe
CR562437 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF740 conjugate, 0.1mg/mL
BNC741173-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZEB Recombinant Rabbit monoclonal Antibody
HA750638 100 µL

ZEB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PIAS2 (NM_004671) Human Over-expression Lysate
LY401487 100 µg

PIAS2 (NM_004671) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF405S conjugate, 0.1mg/mL
BNC040045-500 1x 500 µL

Bcl-2 (100/D5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse COL1 (Collagen Type I) ELISA Kit
E-EL-M0325-01 24 Tests

Mouse COL1 (Collagen Type I) ELISA Kit

Sign In for Pricing
View Details