Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A0JWX7

Expression Region

1-286

Origin

Arthrobacter sp. (strain FB24)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHDVGSINVNWFEAALLGLVQGLTEFLPISSSAHLRIVGSFLPNAADPGAAFTAITQLG TETAVIVYFWRDIVRIVKAWAGTLTRRVPTDDPDARMGWLVILGSLPIIVLGLIFQDQIE SVLRSLWIVATMLIVFGLILAVADAVGRQERELTRLTYKHGIFYGFAQAMALIPGVSRSG GTITAGLLMGYTREAAARYSFLLAIPAVFGSGLYQLYKVMSKDGITGPYGLPETALATLI AFVVGYVIIGWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFNVISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MSRB3 Antibody Picoband®, Cy3 Conjugate
A06632-1-Cy3 100 µg/Vial

Anti-MSRB3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Methadone discontinued
471084 1 mL

Methadone discontinued

Sign In for Pricing
View Details
SLC25A33 Rabbit Polyclonal Antibody
TA357698 100 µL

SLC25A33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Multiple Vacuum Filtration System
VFG0310-3 1 Each

Multiple Vacuum Filtration System

Sign In for Pricing
View Details
DEFA1 Antibody
CSB-PA919793-01 50 μL

DEFA1 Antibody

Sign In for Pricing
View Details
DEFA1 Antibody
CSB-PA919793-02 100 µL

DEFA1 Antibody

Sign In for Pricing
View Details