Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A0JWX7

Expression Region

1-286

Origin

Arthrobacter sp. (strain FB24)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHDVGSINVNWFEAALLGLVQGLTEFLPISSSAHLRIVGSFLPNAADPGAAFTAITQLG TETAVIVYFWRDIVRIVKAWAGTLTRRVPTDDPDARMGWLVILGSLPIIVLGLIFQDQIE SVLRSLWIVATMLIVFGLILAVADAVGRQERELTRLTYKHGIFYGFAQAMALIPGVSRSG GTITAGLLMGYTREAAARYSFLLAIPAVFGSGLYQLYKVMSKDGITGPYGLPETALATLI AFVVGYVIIGWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFNVISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp213 AAV Vector (Rat) (CMV)
50876106 1 µg

Zfp213 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SPG48 Rabbit Polyclonal Antibody (FITC)
orb466743 100 µL

SPG48 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
DNA Polymerase lambda (POLL) (NM_013274) Human Tagged Lenti ORF Clone
RC209816L4 10 µg

DNA Polymerase lambda (POLL) (NM_013274) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Zc4H2 Polyclonal Antibody
CAC08117-01 50 µg

Zc4H2 Polyclonal Antibody

Sign In for Pricing
View Details
Zc4H2 Polyclonal Antibody
CAC08117-02 100 µg

Zc4H2 Polyclonal Antibody

Sign In for Pricing
View Details
GNL3L, NT (GNL3L, Guanine nucleotide-binding protein-like 3-like protein) (PE) discontinued
036147-PE 200 µL

GNL3L, NT (GNL3L, Guanine nucleotide-binding protein-like 3-like protein) (PE) discontinued

Sign In for Pricing
View Details