Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Arthrobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A0JWX7

Expression Region

1-286

Origin

Arthrobacter sp. (strain FB24)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHDVGSINVNWFEAALLGLVQGLTEFLPISSSAHLRIVGSFLPNAADPGAAFTAITQLG TETAVIVYFWRDIVRIVKAWAGTLTRRVPTDDPDARMGWLVILGSLPIIVLGLIFQDQIE SVLRSLWIVATMLIVFGLILAVADAVGRQERELTRLTYKHGIFYGFAQAMALIPGVSRSG GTITAGLLMGYTREAAARYSFLLAIPAVFGSGLYQLYKVMSKDGITGPYGLPETALATLI AFVVGYVIIGWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFNVISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2 Antibody
F47549-0.4ML 0.4 mL

AP2 Antibody

Sign In for Pricing
View Details
Fcgrt Rat shRNA Plasmid (Locus ID 29558)
TL711699 1 Kit

Fcgrt Rat shRNA Plasmid (Locus ID 29558)

Sign In for Pricing
View Details
LMAN2L Antibody, HRP conjugated
CSB-PA863945LB01HU-01 50 µg

LMAN2L Antibody, HRP conjugated

Sign In for Pricing
View Details
LMAN2L Antibody, HRP conjugated
CSB-PA863945LB01HU-02 100 µg

LMAN2L Antibody, HRP conjugated

Sign In for Pricing
View Details
Myxococcales bacterium EOO73_05625 Rabbit Polyclonal Antibody (Biotin)
orb2570629 200 µL

Myxococcales bacterium EOO73_05625 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
OsTip3-1 Rabbit pAb
orb2706169-01 50 µL

OsTip3-1 Rabbit pAb

Sign In for Pricing
View Details