Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium novyi Undecaprenyl-diphosphatase (uppP)

This Recombinant Clostridium novyi Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A0Q210

Expression Region

1-286

Origin

Clostridium novyi (strain NT)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLWFIIKAIIIGIVEGITEFLPVSSTGHMIIVEDLINFKEGVMPASLYTKQYIDAFTM IIQLGAILAIVVLYWDKIKRSFENFAPSKPKSGFKFWLNIAVSAVPAGVLGLKFHSKINE KLFNPGSVTAALIVGAIWMIFAEKRYRGKFTTKDIDNVTIKQAFIIGCFQCLALWPGMSR SASTIIGAWIVGLSTVAAAEFSFFLALPVMAGVTYKSLKDINVFALGSMHIVGLTVGFIV SFIVALIVVDKFITFLKKKPMRVFAMYRILLGIVLIILSLFNVISM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL
BNC740714-100 1x 100 µL

Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details