Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A5GNW2

Expression Region

1-286

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESAVSEPGLLEAIWRDFVLGVVQGLTEFLPISSTAHLKIVPVLAGWGDPGVSVTAVIQL GSIVAVIAYFRADLAAVLRGISGAVRRGQWREPEARLGIAMTIGTLPILFAGLAIKLYWP GYETSPLRSVPAIAGVSILMALLLALAERFGPRSKQLDQVQGRDGLLVGLAQVLALIPGV SRSGSTLTASLFDSWKRPDAARFSFLLGIPAITIAGLVELKDAFTEPSAGGVLPLMVGIV SAAVVSWLAIDWLLKFLQRHSTWVFVIYRLLFGILLLAWWAGSGSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MICA (MHC class I chain-related protein A) ELISA Kit
EK247902 96 Well

Human MICA (MHC class I chain-related protein A) ELISA Kit

Sign In for Pricing
View Details
Rcc1 Rat shRNA Plasmid (Locus ID 682908)
TL708504 1 Kit

Rcc1 Rat shRNA Plasmid (Locus ID 682908)

Sign In for Pricing
View Details
Recombinant Human YME1L1 Protein - (Dry Ice)
H00010730-P01-25ug 25 µg

Recombinant Human YME1L1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Chicken CP (Ceruloplasmin) ELISA Kit
MBS2512596-01 24 Tests

Chicken CP (Ceruloplasmin) ELISA Kit

Sign In for Pricing
View Details
Chicken CP (Ceruloplasmin) ELISA Kit
MBS2512596-02 48 Tests

Chicken CP (Ceruloplasmin) ELISA Kit

Sign In for Pricing
View Details
Chicken CP (Ceruloplasmin) ELISA Kit
MBS2512596-03 96 Tests

Chicken CP (Ceruloplasmin) ELISA Kit

Sign In for Pricing
View Details