Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Teredinibacter turnerae Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Teredinibacter turnerae Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

C5BMA2

Expression Region

1-286

Origin

Teredinibacter turnerae (strain ATCC 39867 / T7901)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKYPEIDPVALSLGSVTVFGKTINLPDIHWYGLMYLFGFILCWAVGTYRAGKPHNVVHK SWLEDLVFYVAMGVVLGGRCGYVFFYNFGAFLDDPLWLFRVWEGGMSFHGGLLGVILAMM LYARKMQVRFLDLMDFVAPLVPIGLGLGRIGNFIGQELWGRVTTLPIGMVFPKDPGVARH PSQLYQAALEGLVLFAVLFWFSSKPRPRAAVASLFLILYGCFRFAVEFVREPDAHIGFDM FGWLTRGQELSLPMIIIGALIFFYAYRHPAYAEKAPDPRANGSKKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL
BNC400668-100 1x 100 µL

MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF568 conjugate, 0.1mg/mL
BNC680859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF740 conjugate, 0.1mg/mL
BNC741908-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF647 conjugate, 0.1mg/mL
BNC472341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF405S conjugate, 0.1mg/mL
BNC041009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details