Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B0UUY3

Expression Region

1-286

Origin

Haemophilus somnus (strain 2336) (Histophilus somni (strain 2336) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFIFGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRESCFNAFLNNNYFGLTVFIAVLFGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Transferrin Receptor 1 Antibody
RC-5430-01 50 μL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Receptor 1 Antibody
RC-5430-02 100 µL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Receptor 1 Antibody
RC-5430-03 1 mL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Cell Navigator® CDy6 Mitosis Imaging Kit
22640-AAT 100 Tests

Cell Navigator® CDy6 Mitosis Imaging Kit

Sign In for Pricing
View Details
Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.),
BAF-443-1 1 mL

Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.),

Sign In for Pricing
View Details
2,6-Dichloropyrazine
TRC-D435825-10G 10 g

2,6-Dichloropyrazine

Sign In for Pricing
View Details