Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B0UUY3

Expression Region

1-286

Origin

Haemophilus somnus (strain 2336) (Histophilus somni (strain 2336) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFIFGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRESCFNAFLNNNYFGLTVFIAVLFGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Phospho-Cyclin D1 (Thr286) Monoclonal Antibody
AN301503L-01 50 µL

Recombinant Phospho-Cyclin D1 (Thr286) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-Cyclin D1 (Thr286) Monoclonal Antibody
AN301503L-02 100 µL

Recombinant Phospho-Cyclin D1 (Thr286) Monoclonal Antibody

Sign In for Pricing
View Details
Human EIF4E3 activation kit by CRISPRa
GA117313 1 Kit

Human EIF4E3 activation kit by CRISPRa

Sign In for Pricing
View Details
CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), 0.2mg/mL
BNUB3063-100 1x 100 µL

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), 0.2mg/mL

Sign In for Pricing
View Details
1,2,3,4,6,7-Hexachloronaphthalene + 1,2,3,5,6,7-Hexachloronaphthalene (Mixture) (~90%)
TRC-H293720-1G 1 g

1,2,3,4,6,7-Hexachloronaphthalene + 1,2,3,5,6,7-Hexachloronaphthalene (Mixture) (~90%)

Sign In for Pricing
View Details
ZZZ3 Polyclonal Antibody
E-AB-18477-01 20 µL

ZZZ3 Polyclonal Antibody

Sign In for Pricing
View Details