Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B0UUY3

Expression Region

1-286

Origin

Haemophilus somnus (strain 2336) (Histophilus somni (strain 2336) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFIFGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRESCFNAFLNNNYFGLTVFIAVLFGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Ovary
CP565561 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
PGC1 beta (PPARGC1B) (NM_133263) Human Over-expression Lysate
LC403333 20 µg

PGC1 beta (PPARGC1B) (NM_133263) Human Over-expression Lysate

Sign In for Pricing
View Details
hnRNP L (HNRNPL) Rabbit Polyclonal Antibody
AP06669PU-N 100 µg

hnRNP L (HNRNPL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Di(2-(4-(dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl))-2-propoxyethyl Propionate
TRC-D417110-10MG 10 mg

Di(2-(4-(dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl))-2-propoxyethyl Propionate

Sign In for Pricing
View Details
VDAC1 Human Gene Knockout Kit (CRISPR)
KN209949LP 1 Kit

VDAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF647 conjugate, 0.1mg/mL
BNC472761-100 1x 100 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details