Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B1KKU2

Expression Region

1-286

Origin

Shewanella woodyi (strain ATCC 51908 / MS32)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVKDKLEIYLRLARMDRPIGTLLLMWPCLMALVLAAGGMPDLKVLVIFIIGVVVMRACG CIINDYADRKLDSHVERTKSRPLASGEVSVKEALTLFVVMGLIAFGLVLMLNPLVVQLSF VGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGTVPAEAWWLFAANWCWTVAY DTMYAMVDRDDDLKVGIKSTAILFGKYDRQVIALFQLAALACFIIAGWAADRGLVYALGI ITFVGFSLYQQKLIYGRERAPCFKAFLNNNWAGLSLFVALGVDYLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFV1 (NM_007103) Human Recombinant Protein
TP304954 20 µg

NDUFV1 (NM_007103) Human Recombinant Protein

Sign In for Pricing
View Details
Human TRAR4 (TAAR6) activation kit by CRISPRa
GA117328 1 Kit

Human TRAR4 (TAAR6) activation kit by CRISPRa

Sign In for Pricing
View Details
(4S)-Brivaracetam-d7
TRC-B677652-1MG 1 mg

(4S)-Brivaracetam-d7

Sign In for Pricing
View Details
Tide Quencher™ 8WS azide [TQ8WS azide]
2136-AAT 1 mg

Tide Quencher™ 8WS azide [TQ8WS azide]

Sign In for Pricing
View Details
OR10T2 Antibody
8G505-AAT 50 µg

OR10T2 Antibody

Sign In for Pricing
View Details
5'-Tosyl-2'-deoxy Adenosine
TRC-T631500-25MG 25 mg

5'-Tosyl-2'-deoxy Adenosine

Sign In for Pricing
View Details