Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B1KKU2

Expression Region

1-286

Origin

Shewanella woodyi (strain ATCC 51908 / MS32)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVKDKLEIYLRLARMDRPIGTLLLMWPCLMALVLAAGGMPDLKVLVIFIIGVVVMRACG CIINDYADRKLDSHVERTKSRPLASGEVSVKEALTLFVVMGLIAFGLVLMLNPLVVQLSF VGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGTVPAEAWWLFAANWCWTVAY DTMYAMVDRDDDLKVGIKSTAILFGKYDRQVIALFQLAALACFIIAGWAADRGLVYALGI ITFVGFSLYQQKLIYGRERAPCFKAFLNNNWAGLSLFVALGVDYLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4"-Desmorpholino,-4"-morpholin-3-on-4-yl Momelotinib Carboxamide
TRC-D965680-5MG 5 mg

4"-Desmorpholino,-4"-morpholin-3-on-4-yl Momelotinib Carboxamide

Sign In for Pricing
View Details
Tomosyn (STXBP5) (NM_001127715) Human Over-expression Lysate
LC426872 20 µg

Tomosyn (STXBP5) (NM_001127715) Human Over-expression Lysate

Sign In for Pricing
View Details
S100A5 (NM_002962) Human Recombinant Protein
TP310891M 100 µg

S100A5 (NM_002962) Human Recombinant Protein

Sign In for Pricing
View Details
AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]
E-AB-F098530-01 100 µg

AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]
E-AB-F098530-02 1 mg

AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]
E-AB-F098530-03 5 mg

AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details