Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

Q0I0W3

Expression Region

1-286

Origin

Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFICGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRASCFNAFLNNNYFGLTVFIAVLFGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse LDLR/LDL Receptor HEK293 Overexpression Lysate
MBS8116523-01 0.3 mg

Mouse LDLR/LDL Receptor HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse LDLR/LDL Receptor HEK293 Overexpression Lysate
MBS8116523-02 5x 0.3 mg

Mouse LDLR/LDL Receptor HEK293 Overexpression Lysate

Sign In for Pricing
View Details
CCDC136 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0385507 1.0 µg DNA

CCDC136 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat Poliovirus Receptor (PVR) Antibody Pair Kit (with Standard)
MBS2100548-01 5x 96 Tests

Rat Poliovirus Receptor (PVR) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Poliovirus Receptor (PVR) Antibody Pair Kit (with Standard)
MBS2100548-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Poliovirus Receptor (PVR) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Poliovirus Receptor (PVR) Antibody Pair Kit (with Standard)
MBS2100548-03 10x 96 Tests

Rat Poliovirus Receptor (PVR) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details