Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

Q0I0W3

Expression Region

1-286

Origin

Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFICGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRASCFNAFLNNNYFGLTVFIAVLFGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPK1 (NM_022445) Human Recombinant Protein
TP309721M 100 µg

TPK1 (NM_022445) Human Recombinant Protein

Sign In for Pricing
View Details
Temiz DVB-NH2 MP
10-03-0100 100 g

Temiz DVB-NH2 MP

Sign In for Pricing
View Details
Rabbit Monoclonal GPHA2 Antibody (064) [PerCP]
NBP2-90250PCP 0.1 mL

Rabbit Monoclonal GPHA2 Antibody (064) [PerCP]

Sign In for Pricing
View Details
(R)-N-Nitroso Anabasine, ~ 98% ee
TRC-N524240-50MG 50 mg

(R)-N-Nitroso Anabasine, ~ 98% ee

Sign In for Pricing
View Details
Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (GCP-04) [DyLight 405]
NBP1-45057V 0.1 mL

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (GCP-04) [DyLight 405]

Sign In for Pricing
View Details
DCXR (NM_016286) Human Untagged Clone
SC128260 10 µg

DCXR (NM_016286) Human Untagged Clone

Sign In for Pricing
View Details