Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)
This Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-286.
Product Specifications
Product Name Alternative
4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase
UniProt
Q0I0W3
Expression Region
1-286
Origin
Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt) )
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFICGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRASCFNAFLNNNYFGLTVFIAVLFGI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1416363-01 0.5 mg (E-Coli)
Recombinant Danio rerio LysM and putative peptidoglycan-binding domain-containing protein 3 (lysmd3), partial
Sign In for Pricing
View Details MBS1416363-02 0.05 mg (Baculovirus)
Recombinant Danio rerio LysM and putative peptidoglycan-binding domain-containing protein 3 (lysmd3), partial
Sign In for Pricing
View Details MBS1416363-03 0.5 mg (Yeast)
Recombinant Danio rerio LysM and putative peptidoglycan-binding domain-containing protein 3 (lysmd3), partial
Sign In for Pricing
View Details MBS1416363-04 0.05 mg (Mammalian-Cell)
Recombinant Danio rerio LysM and putative peptidoglycan-binding domain-containing protein 3 (lysmd3), partial
Sign In for Pricing
View Details MBS1416363-05 1 mg (E-Coli)
Recombinant Danio rerio LysM and putative peptidoglycan-binding domain-containing protein 3 (lysmd3), partial
Sign In for Pricing
View Details