Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus Type 4 prepilin-like proteins leader peptide-processing enzyme (fimP)

This Recombinant Dichelobacter nodosus Type 4 prepilin-like proteins leader peptide-processing enzyme (fimP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

Q46525

Expression Region

1-286

Origin

Dichelobacter nodosus (Bacteroides nodosus)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLISELLQTPLGIFFVGLFSLMVGSFLNVVIYRVPVMMDREEKQYAWQVFHGEDSVCPEI PKQRFNLLVPASRCPHCGHRIRAIENIPVISWLFLKGKCSGCGAAISARYLLVELLTAAL SVIVAFHYHDPLSLGFALVFTWTLIALCFIDAEHQLLPDRLTLPLLWLGILAALFNVFIN LESSVIGAMIGYLSLWSVYWLFKLITGREGMGYGDFKLLACLCAWQGAWMLPIILFSAAI LGMIYALGIGLRMGKPMPFGPFLAIAGWLTFLYGAQIGQLFGYFPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMOX2 Antibody
KC-13298-01 50 μL

HMOX2 Antibody

Sign In for Pricing
View Details
HMOX2 Antibody
KC-13298-02 100 µL

HMOX2 Antibody

Sign In for Pricing
View Details
HMOX2 Antibody
KC-13298-03 1 mL

HMOX2 Antibody

Sign In for Pricing
View Details
TSPO2 (NM_001159726) Human Over-expression Lysate
LC431773 20 µg

TSPO2 (NM_001159726) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Protein Kinase, AMP Activated Alpha 1 (PRKAa1) ELISA Kit
RDR-PRKAa1-Mu-01 96 Tests

Mouse Protein Kinase, AMP Activated Alpha 1 (PRKAa1) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Kinase, AMP Activated Alpha 1 (PRKAa1) ELISA Kit
RDR-PRKAa1-Mu-02 48 Tests

Mouse Protein Kinase, AMP Activated Alpha 1 (PRKAa1) ELISA Kit

Sign In for Pricing
View Details