Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus Type 4 prepilin-like proteins leader peptide-processing enzyme (fimP)

This Recombinant Dichelobacter nodosus Type 4 prepilin-like proteins leader peptide-processing enzyme (fimP) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

Q46525

Expression Region

1-286

Origin

Dichelobacter nodosus (Bacteroides nodosus)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLISELLQTPLGIFFVGLFSLMVGSFLNVVIYRVPVMMDREEKQYAWQVFHGEDSVCPEI PKQRFNLLVPASRCPHCGHRIRAIENIPVISWLFLKGKCSGCGAAISARYLLVELLTAAL SVIVAFHYHDPLSLGFALVFTWTLIALCFIDAEHQLLPDRLTLPLLWLGILAALFNVFIN LESSVIGAMIGYLSLWSVYWLFKLITGREGMGYGDFKLLACLCAWQGAWMLPIILFSAAI LGMIYALGIGLRMGKPMPFGPFLAIAGWLTFLYGAQIGQLFGYFPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wbp2 Mouse Gene Knockout Kit (CRISPR)
KN519321 1 Kit

Wbp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,2,3-Tribromobenzene
TRC-T771860-500MG 500 mg

1,2,3-Tribromobenzene

Sign In for Pricing
View Details
4-Bromobenzenesulfonyl Chloride
TRC-B680170-50G 50 g

4-Bromobenzenesulfonyl Chloride

Sign In for Pricing
View Details
Pregnancy Specific Glycoprotein 1 (PSG1) (NM_001297773) Human Tagged ORF Clone
RG238171 10 µg

Pregnancy Specific Glycoprotein 1 (PSG1) (NM_001297773) Human Tagged ORF Clone

Sign In for Pricing
View Details
CK1 epsilon (CSNK1E) (NM_001894) Human Over-expression Lysate
LY419672 100 µg

CK1 epsilon (CSNK1E) (NM_001894) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NPIPA3 activation kit by CRISPRa
GA118671 1 Kit

Human NPIPA3 activation kit by CRISPRa

Sign In for Pricing
View Details