Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P33566

Expression Region

1-286

Origin

Neisseria gonorrhoeae

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDLSVLSPFAVPLAAVLGLLVGSFLNVVIYRVPVMMERGWTVFAKEHLNLPLTDDESRT FNLMKPDSCCPKCRVPIRAWQNIPIVSYLLLRGKCASCQTKISIRYPLIELLTGVLFGLV AWQYGWSWITLGGLILTAFLISLTFIDADTQYLPDSMTLPLIWLGLIFNLDGGFVPLQSA VLGAVAGYSSLWLLCAVYKLLTGKTGMGNGDFKLIAALGAWLGISALPVLIFVSSLIGLV AAIVMRVAKGRHFAFGPALTVSGWIIFTANDSVWRAVNWWLTHPVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIP9 CRISPR Activation Plasmid (h2)
sc-417783-ACT-2 20 µg

ZIP9 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Mouse Npr2 Pre-designed siRNA Set A
SI109530A 1 Each

Mouse Npr2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ASB6 Blocking Peptide
MBS9633430-01 1 mg

ASB6 Blocking Peptide

Sign In for Pricing
View Details
ASB6 Blocking Peptide
MBS9633430-02 5x 1 mg

ASB6 Blocking Peptide

Sign In for Pricing
View Details
2-[1- (3-carbamoylpropyl) -4-hexyl-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl]acetic acid
orb3179266-01 1 mg

2-[1- (3-carbamoylpropyl) -4-hexyl-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl]acetic acid

Sign In for Pricing
View Details
2-[1- (3-carbamoylpropyl) -4-hexyl-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl]acetic acid
orb3179266-02 2 mg

2-[1- (3-carbamoylpropyl) -4-hexyl-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl]acetic acid

Sign In for Pricing
View Details