Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Burkholderia cenocepacia 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Burkholderia cenocepacia 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

A0K4Q5

Expression Region

1-287

Origin

Burkholderia cenocepacia (strain HI2424)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLARFPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGRPRWPLLVIFTLGTLLMRSAGCA MNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVGLSFIAFLLILPLNTLTKELSVVA LFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMLAWVMLVANIFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAVMACYAATLGIYVWIGVTLGFGLAYWVGWAA AVGCALYHYTLIKDRERMPCFAAFRHNNWLGGVLFAGIAAHYLLAGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
BNC880676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details