Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Burkholderia phymatum 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Burkholderia phymatum 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B2JGG3

Expression Region

1-287

Origin

Burkholderia phymatum (strain DSM 17167 / STM815)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPSVSLLVIFALGTILMRSAGCA INDYADRDFDRYVKRTENRPITSGKIKAWEAVALAAGLSLVAFLLILPLNALTKELSVAA LFVAGTYPFTKRFFAIPQAYLGIAFGFGIPMAFAAVQNQVPLLAWVMLIANVFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVLAIMLCYAVTLGIYVGIGFTLGFGVLYWIGLAA AAGCAVYHYTLIKGRERMPCFAAFRHNNWLGGALFAGIAAHYAAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR5 Rabbit Polyclonal Antibody
TA366995 100 µL

CCR5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,4-Dihydroharmine
TRC-D449718-500MG 500 mg

3,4-Dihydroharmine

Sign In for Pricing
View Details
Human SNRNP25 activation kit by CRISPRa
GA112494 1 Kit

Human SNRNP25 activation kit by CRISPRa

Sign In for Pricing
View Details
Crude Trifolium repens Lectin (White Clover) -RTA-20mg
L-5800-20 20 mg

Crude Trifolium repens Lectin (White Clover) -RTA-20mg

Sign In for Pricing
View Details
Hras1 (BC011083) Mouse Tagged ORF Clone
MG200555 10 µg

Hras1 (BC011083) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DUX4L6 Human Gene Knockout Kit (CRISPR)
KN425828 1 Kit

DUX4L6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details