Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Pectobacterium carotovorum subsp. carotovorum 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

C6DKC9

Expression Region

1-287

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERSVTAGKWLAYCRLMRIDKPIGSLLLLWPTLWALWLAGGGAPAPWTLFVFVAGVFLMR AAGCVINDYADRHFDGHVKRTASRPLPSGEVSEQSAKVLFVVLVLLAFGLVLTLNTMTIW LSVAGLGLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSESLPATCWMMFLAYICWT VAYDTQYAMVDRDDDLKIGVKSTAILFGRFDNLIIGLLQFSMLALLLILGTMTGLGMPYY ISLLVAGGMFIYQQILTAGRERDACFKAFHNNKYAGMAIFIGVLFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSF-1-R Recombinant Rabbit monoclonal Antibody
HA723478B 100 µL

Human CSF-1-R Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9B3]
TA803550BM 100 µL

Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9B3]

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS501353 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details
FYB2 (NM_001004303) Human Over-expression Lysate
LY424080 100 µg

FYB2 (NM_001004303) Human Over-expression Lysate

Sign In for Pricing
View Details
Pilaralisib
TRC-P441390-10MG 10 mg

Pilaralisib

Sign In for Pricing
View Details