What is the catalog number for Recombinant Rat Zinc transporter ZIP9 (Slc39a9)?

The catalog number for Recombinant Rat Zinc transporter ZIP9 (Slc39a9) is orb2907281.

What sizes are available for Recombinant Rat Zinc transporter ZIP9 (Slc39a9)?

Recombinant Rat Zinc transporter ZIP9 (Slc39a9) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Rat Zinc transporter ZIP9 (Slc39a9) come in?

Recombinant Rat Zinc transporter ZIP9 (Slc39a9) is available in 2 different pack sizes.

Is Recombinant Rat Zinc transporter ZIP9 (Slc39a9) in stock?

Recombinant Rat Zinc transporter ZIP9 (Slc39a9) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Rat Zinc transporter ZIP9 (Slc39a9)

This Recombinant Rat Zinc transporter ZIP9 (Slc39a9) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Zinc transporter ZIP9, Solute carrier family 39 member 9, Zrt- and Irt-like protein 9, ZIP-9

UniProt

Q3KR82

Expression Region

1-287

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDFLSISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH ALYEEVLEGKHHQASEAKQNVIASDKAAEISVVHEHEHSHDHTQLHAYIGVSLVLGFVFM LLVDQIGSSHVHSTDDPESARPSSSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVF VAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPAMSMLTYLGLSKSSKEALSE VNATGVAMLFSAGTFLYVATVHVLPEDTSTNQSGSSLSPRPLPSGKN