Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q7W866

Expression Region

1-287

Origin

Bordetella parapertussis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDSTLHLLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSSGKVFEVVIQFGSILA VMWIFRARLWQLIRGTLTGVRQEVNFTRNLLLAFLPAAVIGAIFIKSIKQVFYHPGVVAV TLVVGGFIMLWVERRAPHTPGDAPGAADDTASDERATAHTLEQISAKQALGVGVAQCVAM IPGVSRSGATIIGGMIAGIQRKTATEFSFFLAMPTMLGAAVYDLYRNIGLLSQHDMSAIA VGFVAAFLSALVVVRAVLRFVANHTYRVFAWYRIALGLVVAAWIYAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anamorelin Impurity 8
RM-A301008-01 10 mg

Anamorelin Impurity 8

Sign In for Pricing
View Details
Anamorelin Impurity 8
RM-A301008-02 25 mg

Anamorelin Impurity 8

Sign In for Pricing
View Details
Anamorelin Impurity 8
RM-A301008-03 50 mg

Anamorelin Impurity 8

Sign In for Pricing
View Details
Anamorelin Impurity 8
RM-A301008-04 100 mg

Anamorelin Impurity 8

Sign In for Pricing
View Details
LARP6 Rabbit Polyclonal Antibody (Cy5)
orb948550 100 µL

LARP6 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Human Lymphocyte antigen 6 complex locus protein G5b (LY6G5B)
MBS1342365-01 0.02 mg (E-Coli)

Recombinant Human Lymphocyte antigen 6 complex locus protein G5b (LY6G5B)

Sign In for Pricing
View Details