Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Taurulus bubalis Rhodopsin (rho)

This Recombinant Taurulus bubalis Rhodopsin (rho) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42466

Expression Region

1-287

Origin

Taurulus bubalis (Long-spined sea scorpion) (Cottus bubalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VNGAAYAGLCAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLGGF TTTMYTSAHGYFVLGRLGCNVEGFFATLGGEIALWSLVVLAVERWIVVCKPISNFRFTEE HAIMGLGFNWVMASACAVPPLVGWSRYIPEGMQCSCGINYYTRSEGFNNESLVMKMLICH FLIPLFVIFFCYGRMLCAVKEAAAAQQESETTQRAEREVSRMVVIMVISFLVCWLPYASV AWYIFCNQGSEFGPVFMTLPAFFAKSASIYNPLIYICMNKHSRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX6 CRISPRa sgRNA lentivector (set of three targets)(Human)
17860121 3x 1.0µg DNA

DDX6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Lentiviral mouse Dhrs7 shRNA (UAS) - Lentiviral mouse Dhrs7 shRNA (UAS) (25)
GTR15285797 1 Vial

Lentiviral mouse Dhrs7 shRNA (UAS) - Lentiviral mouse Dhrs7 shRNA (UAS) (25)

Sign In for Pricing
View Details
ELISA Kit For Ninjurin-2
E13393h 96 Tests

ELISA Kit For Ninjurin-2

Sign In for Pricing
View Details
ARG2 (Arginase-2, Mitochondrial, Kidney-type Arginase, Non-hepatic Arginase, Type II Arginase) (MaxLight 405) discontinued
123476-ML405 100 µL

ARG2 (Arginase-2, Mitochondrial, Kidney-type Arginase, Non-hepatic Arginase, Type II Arginase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Advanced glycation end products (AGEs) ELISA Kit
EIA05031h 1 Kit

Human Advanced glycation end products (AGEs) ELISA Kit

Sign In for Pricing
View Details
CLEC11A Antibody (Center)
E45R30725G-4 50 µL

CLEC11A Antibody (Center)

Sign In for Pricing
View Details