Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Taurulus bubalis Rhodopsin (rho)

This Recombinant Taurulus bubalis Rhodopsin (rho) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42466

Expression Region

1-287

Origin

Taurulus bubalis (Long-spined sea scorpion) (Cottus bubalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VNGAAYAGLCAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLGGF TTTMYTSAHGYFVLGRLGCNVEGFFATLGGEIALWSLVVLAVERWIVVCKPISNFRFTEE HAIMGLGFNWVMASACAVPPLVGWSRYIPEGMQCSCGINYYTRSEGFNNESLVMKMLICH FLIPLFVIFFCYGRMLCAVKEAAAAQQESETTQRAEREVSRMVVIMVISFLVCWLPYASV AWYIFCNQGSEFGPVFMTLPAFFAKSASIYNPLIYICMNKHSRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mad (MXD1) (NM_002357) Human Tagged ORF Clone
RC210520 10 µg

Mad (MXD1) (NM_002357) Human Tagged ORF Clone

Sign In for Pricing
View Details
pECMV-Fitm2-m-FLAG Plasmid
PVT15039 2 µg

pECMV-Fitm2-m-FLAG Plasmid

Sign In for Pricing
View Details
MMP13 (Matrix Metalloproteinase 13, CLG3, MANDP1) (Biotin)
MBS6426905-01 0.1 mL

MMP13 (Matrix Metalloproteinase 13, CLG3, MANDP1) (Biotin)

Sign In for Pricing
View Details
MMP13 (Matrix Metalloproteinase 13, CLG3, MANDP1) (Biotin)
MBS6426905-02 5x 0.1 mL

MMP13 (Matrix Metalloproteinase 13, CLG3, MANDP1) (Biotin)

Sign In for Pricing
View Details
GNG5P siRNA Oligos set (Human)
58267171 3x 5 nmol

GNG5P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Anterior Gradient Protein 2 (AGR2) ELISA Kit
DLR-AGR2-Mu-01 48 Tests

Mouse Anterior Gradient Protein 2 (AGR2) ELISA Kit

Sign In for Pricing
View Details