Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-1 (srg-1)

This Recombinant Serpentine receptor class gamma-1 (srg-1) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-1, Protein srg-1

UniProt

P46570

Expression Region

1-288

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPINETASVTNCDTNFEPLIENLKLFLQLCYLTPSALFLSRVIYITAWKYRKKFRKQRFY TIFLADCVTGFILVNFSIFFTRPLIYVPQACEFVLEHIKKLALFLDIYYPCFRYLQAFQI LVQILFVANRASCVLWPLSYSLFWKKWLKSILTTMAISPCLWIWTIAISDKMIVHGYGGL VVLYYRYVSWARSTLFFSILRLTSVITIVVATTTMLIKMSRMKKRIRESERRLCWASVYL SVCYLLPAIAEFEYFLVLKAKLFENSGILHGLVVICWDIQNICSTYVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC34A2 Antibody Picoband® (Dylight488 Conjugate)
A03957-1-Dylight488 100 µg

Anti-SLC34A2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
ZBP1 Polyclonal Antibody
BT-AP15607-01 20 µL

ZBP1 Polyclonal Antibody

Sign In for Pricing
View Details
ZBP1 Polyclonal Antibody
BT-AP15607-02 50 µL

ZBP1 Polyclonal Antibody

Sign In for Pricing
View Details
ZBP1 Polyclonal Antibody
BT-AP15607-03 100 µL

ZBP1 Polyclonal Antibody

Sign In for Pricing
View Details
eIF2C1 Double Nickase Plasmid (m)
sc-437349-NIC 20 µg

eIF2C1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
H-Cys-OH · HCl · H2O
E-1755.0100 100.0g

H-Cys-OH · HCl · H2O

Sign In for Pricing
View Details