Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-1 (srg-1)

This Recombinant Serpentine receptor class gamma-1 (srg-1) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-1, Protein srg-1

UniProt

P46570

Expression Region

1-288

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPINETASVTNCDTNFEPLIENLKLFLQLCYLTPSALFLSRVIYITAWKYRKKFRKQRFY TIFLADCVTGFILVNFSIFFTRPLIYVPQACEFVLEHIKKLALFLDIYYPCFRYLQAFQI LVQILFVANRASCVLWPLSYSLFWKKWLKSILTTMAISPCLWIWTIAISDKMIVHGYGGL VVLYYRYVSWARSTLFFSILRLTSVITIVVATTTMLIKMSRMKKRIRESERRLCWASVYL SVCYLLPAIAEFEYFLVLKAKLFENSGILHGLVVICWDIQNICSTYVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp1 (E-3) Alexa Fluor® 546
sc-17824 AF546 200 µg/mL

Sp1 (E-3) Alexa Fluor® 546

Sign In for Pricing
View Details
1,2-Bis (4-fluorophenyl) ethanone
410591-01 250 mg

1,2-Bis (4-fluorophenyl) ethanone

Sign In for Pricing
View Details
1,2-Bis (4-fluorophenyl) ethanone
410591-02 1 g

1,2-Bis (4-fluorophenyl) ethanone

Sign In for Pricing
View Details
pDNR-LIB-TVP23B Plasmid
PVT27303 2 µg

pDNR-LIB-TVP23B Plasmid

Sign In for Pricing
View Details
BCL2 Antibody
orb534849-01 20 µg

BCL2 Antibody

Sign In for Pricing
View Details
BCL2 Antibody
orb534849-02 100 µg

BCL2 Antibody

Sign In for Pricing
View Details