Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Protein pilD, Protein secretion protein XCPA, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Alternative name

UniProt

P36642

Expression Region

1-288

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWTFLAMEPAYFITLATVLGLLVGSFLNVVVYRLPIMLERQWQREAHEVLGLPVTEHE RFDLCLPASQCTQCGHRIRAWENLPVLSYLALRGRCSACKQRISVRYPLVEVGCALLSMV VAWRYGASVEALVLLPLTWSLLALSLIDHDQQLLPDAIVLPGLWLGLIVNYFGVWVPLPD AVCGAVVGYLSLWTVYWLFKLVTGKEGMGYGDFKLLALLGAWGGWQVLPLTLLLSSVLGA LVGVYLLRVRNDSMGTAMPFGPYLAIAGWIAVLWGDEIYASNMQLLGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E.DERIVIÈRE450X52RL-T1-LL-P16 Pipe Markers for Water
N001707 30 Pack (30 Marker (s) x 1 Roll)

E.DERIVIÈRE450X52RL-T1-LL-P16 Pipe Markers for Water

Sign In for Pricing
View Details
RHCE Rabbit Polyclonal Antibody (APC-Cy7)
orb2407132 100 µL

RHCE Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Neuropilin 1 Polyclonal Antibody, RBITC Conjugated
bs-0693R-RBITC 100 µL

Neuropilin 1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR562577 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Recombinant Human RAB3GAP2 Protein
E30P11492 20 µg

Recombinant Human RAB3GAP2 Protein

Sign In for Pricing
View Details
Mouse Monoclonal CITED4 Antibody (HT13-2D6.3) [Alexa Fluor 750]
NB110-41572AF750 0.1 mL

Mouse Monoclonal CITED4 Antibody (HT13-2D6.3) [Alexa Fluor 750]

Sign In for Pricing
View Details