Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Protein pilD, Protein secretion protein XCPA, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Alternative name

UniProt

P36642

Expression Region

1-288

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWTFLAMEPAYFITLATVLGLLVGSFLNVVVYRLPIMLERQWQREAHEVLGLPVTEHE RFDLCLPASQCTQCGHRIRAWENLPVLSYLALRGRCSACKQRISVRYPLVEVGCALLSMV VAWRYGASVEALVLLPLTWSLLALSLIDHDQQLLPDAIVLPGLWLGLIVNYFGVWVPLPD AVCGAVVGYLSLWTVYWLFKLVTGKEGMGYGDFKLLALLGAWGGWQVLPLTLLLSSVLGA LVGVYLLRVRNDSMGTAMPFGPYLAIAGWIAVLWGDEIYASNMQLLGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-UFM1 Antibody Picoband® FITC Conjugated
A05543-1-FITC 100 µg/Vial

Anti-UFM1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
MAGI2 siRNA (Human)
CRH6613-01 15 nmol

MAGI2 siRNA (Human)

Sign In for Pricing
View Details
MAGI2 siRNA (Human)
CRH6613-02 30 nmol

MAGI2 siRNA (Human)

Sign In for Pricing
View Details
Anti-CENPQ Mouse Monoclonal Antibody [Clone ID: OTI1C5]
M11703 100 µL

Anti-CENPQ Mouse Monoclonal Antibody [Clone ID: OTI1C5]

Sign In for Pricing
View Details
WH-4-023 (Src inhibitor)
SC1220-10mM 10 mM x 0.2 mL

WH-4-023 (Src inhibitor)

Sign In for Pricing
View Details
Anti-Mouse ITSN2 (KIAA1256), Rabbit Polyclonal
MKA1256 Inquire

Anti-Mouse ITSN2 (KIAA1256), Rabbit Polyclonal

Sign In for Pricing
View Details