Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Protein pilD, Protein secretion protein XCPA, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Alternative name

UniProt

P36642

Expression Region

1-288

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWTFLAMEPAYFITLATVLGLLVGSFLNVVVYRLPIMLERQWQREAHEVLGLPVTEHE RFDLCLPASQCTQCGHRIRAWENLPVLSYLALRGRCSACKQRISVRYPLVEVGCALLSMV VAWRYGASVEALVLLPLTWSLLALSLIDHDQQLLPDAIVLPGLWLGLIVNYFGVWVPLPD AVCGAVVGYLSLWTVYWLFKLVTGKEGMGYGDFKLLALLGAWGGWQVLPLTLLLSSVLGA LVGVYLLRVRNDSMGTAMPFGPYLAIAGWIAVLWGDEIYASNMQLLGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIBAN Rabbit Polyclonal Antibody
BT-AP00145-01 20 µL

NIBAN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NIBAN Rabbit Polyclonal Antibody
BT-AP00145-02 50 µL

NIBAN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NIBAN Rabbit Polyclonal Antibody
BT-AP00145-03 100 µL

NIBAN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
qPCR SybrMaster lowROXMaster mix for real-time qPCR with SYBR® Green fluorescent DNA stain
M-PCR-373L 10 Tubes (1.25 ml each) μTubes (1.25 ml each)

qPCR SybrMaster lowROXMaster mix for real-time qPCR with SYBR® Green fluorescent DNA stain

Sign In for Pricing
View Details
Lentiviral mouse Nphp4 shRNA (UAS) - Lentiviral mouse Nphp4 shRNA (UAS) (25)
GTR15200357 1 Vial

Lentiviral mouse Nphp4 shRNA (UAS) - Lentiviral mouse Nphp4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Kcnh2 (NM_013569) Mouse Untagged Clone
MC223792 10 µg

Kcnh2 (NM_013569) Mouse Untagged Clone

Sign In for Pricing
View Details