Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leocottus kesslerii Rhodopsin (rho)

This Recombinant Leocottus kesslerii Rhodopsin (rho) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q90373

Expression Region

1-289

Origin

Leocottus kesslerii (Kessler's sculpin) (Cottus kesslerii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLVSPAGYAALGAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFVTLGGEIALWSLVVLAIERWIGVFKSIRNFRFT EDHAIMGLGFSWVMAATCAVPPLVGWLRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLIVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGYLVCWLPYA SVAWWIFCNQGSEFGPIFMTLPAFFAKSPAIYNPLIYICMNKQFPHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Demecarium Bromide
TRC-D230720-50MG 50 mg

Demecarium Bromide

Sign In for Pricing
View Details
P2X6 (P2RX6) (NM_005446) Human Over-expression Lysate
LC401674 20 µg

P2X6 (P2RX6) (NM_005446) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 Protein (Fc Tag)
PKSQ050021-01 10 µg

Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 Protein (Fc Tag)
PKSQ050021-02 50 µg

Recombinant Cynomolgus TIGIT/VSIG9/VSTM3 Protein (Fc Tag)

Sign In for Pricing
View Details
Zfr2 Mouse Gene Knockout Kit (CRISPR)
KN520063 1 Kit

Zfr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details