Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Comephorus dybowskii Rhodopsin (rho)

This Recombinant Comephorus dybowskii Rhodopsin (rho) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42327

Expression Region

1-289

Origin

Comephorus dybowskii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLVNPAAYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALSCSVPPLVGWSRYIPEAMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRSEKEVSRMVVLMVIGFLVCWLPYA STAWWIFCNQGSEFGPVFMTIPAFFAKSSAIYNPMIYICMNKQFRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM8 Rabbit pAb
E45R18122N-50 50 µL

ADAM8 Rabbit pAb

Sign In for Pricing
View Details
ZNF84 CRISPRa sgRNA lentivector (set of three targets)(Human)
51878121 3x 1.0µg DNA

ZNF84 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)
orb2703656-01 1 mg

CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)

Sign In for Pricing
View Details
CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)
orb2703656-02 5 mg

CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)

Sign In for Pricing
View Details
CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)
orb2703656-03 100 mg

CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)

Sign In for Pricing
View Details
BLZF1 antibody - C-terminal region (ARP38376_P050)
ARP38376_P050 100 µL

BLZF1 antibody - C-terminal region (ARP38376_P050)

Sign In for Pricing
View Details