Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Comephorus dybowskii Rhodopsin (rho)

This Recombinant Comephorus dybowskii Rhodopsin (rho) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42327

Expression Region

1-289

Origin

Comephorus dybowskii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLVNPAAYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALSCSVPPLVGWSRYIPEAMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRSEKEVSRMVVLMVIGFLVCWLPYA STAWWIFCNQGSEFGPVFMTIPAFFAKSSAIYNPMIYICMNKQFRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

epithelial Sodium Channel alpha (SCNN1A) Rabbit Polyclonal Antibody
TA325073 400 µL

epithelial Sodium Channel alpha (SCNN1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MREG shRNA (m) Lentiviral Particles
sc-149550-V 200 µL

MREG shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CXCR2 Polyclonal Antibody
A62782-020 20 µL

CXCR2 Polyclonal Antibody

Sign In for Pricing
View Details
LAYN (NM_178834) Human Tagged ORF Clone Lentiviral Particle
RC206197L1V 200 µL

LAYN (NM_178834) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AKAP3 Antibody
MBS8596001-01 0.1 mg

AKAP3 Antibody

Sign In for Pricing
View Details
AKAP3 Antibody
MBS8596001-02 0.1 mL (AF405L)

AKAP3 Antibody

Sign In for Pricing
View Details