Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Limnocottus bergianus Rhodopsin (rho)

This Recombinant Limnocottus bergianus Rhodopsin (rho) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42427

Expression Region

1-289

Origin

Limnocottus bergianus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLVNPAGYAALGAYMFLLILIGSPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYSVLGRLGCILEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRPEKEVTRMVVIMVIAFLVCCLPNA SVAWWIFCNQGSDFGPIFMTLPSFFAKSAAIYNPMIYICMNKQFRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
BNC940012-500 1x 500 µL

Tyrosinase (T311), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details